PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06477.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 498aa    MW: 55093.5 Da    PI: 6.3674
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06477.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.8e-52461731128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yLk+kv gk++++ ++i+evd+yk+ePwdL   +++k++++e+yfFs  dkky +g r nrat++gyWkatg+d++v++ +++
  PK06477.1  46 LAPGFRFHPTDEELVIYYLKRKVCGKTFRF-NAITEVDVYKSEPWDLGdkSSLKSRDQEYYFFSALDKKYGNGARMNRATNQGYWKATGNDRPVKR-DSK 143
                579*************************99.89**************64347888999*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vglkktLvf++grap+g++t+Wvmheyrl
  PK06477.1 144 TVGLKKTLVFHSGRAPDGKRTNWVMHEYRL 173
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5842198IPR003441NAC domain
PROSITE profilePS5100556.72246198IPR003441NAC domain
PfamPF023652.2E-2648173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MGRESLVAAQ RAMAAPPTSP PSLSLSVPSE KTRLAPQAKT PAAPTLAPGF RFHPTDEELV  60
IYYLKRKVCG KTFRFNAITE VDVYKSEPWD LGDKSSLKSR DQEYYFFSAL DKKYGNGARM  120
NRATNQGYWK ATGNDRPVKR DSKTVGLKKT LVFHSGRAPD GKRTNWVMHE YRLVEEELER  180
GRGGATQDAF VLCRIFHKSN IGPPSGQRYA PFIEEEWEDD ESAVVPGINN GDDVAAAPGC  240
NKNVGGNNEI VCAEGNNHGT SIERNTCDTY IEGDTIQKDT ESTEKDVHHA LVLPREKQNV  300
LRVCKIERQD DYTMPCVVNR EDSLDGRSVP GLDEQQHLSL GDRVSSPLLM YKRRRHNDSS  360
SSNGVASENS GGAAQDRSSS TTTAATTMST VTTATTRPPT TRNFLSALVE YSLLESIEPK  420
ESTPVPPELD AGNTDSALSP SCLKFIQDLQ REIHQISIER DTLKFEMMSA QAMINILQSR  480
IEVLNKENSD LKRSSGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-494520019170NAC domain-containing protein 19
3swp_C4e-494520019170NAC domain-containing protein 19
3swp_B4e-494520019170NAC domain-containing protein 19
3swp_A4e-494520019170NAC domain-containing protein 19
3swm_D4e-494520019170NAC domain-containing protein 19
3swm_C4e-494520019170NAC domain-containing protein 19
3swm_B4e-494520019170NAC domain-containing protein 19
3swm_A4e-494520019170NAC domain-containing protein 19
4dul_B4e-494520016167NAC domain-containing protein 19
4dul_A4e-494520016167NAC domain-containing protein 19
1ut7_B4e-494520016167NO APICAL MERISTEM PROTEIN
1ut7_A4e-494520016167NO APICAL MERISTEM PROTEIN
1ut4_B4e-494520016167NO APICAL MERISTEM PROTEIN
1ut4_A4e-494520016167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090441.10.0NAC domain-containing protein 78
TrEMBLW9R7650.0W9R765_9R
STRINGGLYMA20G33430.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.21e-117NAC domain containing protein 52